PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934920.1
Common Namemads9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 207aa    MW: 23699.3 Da    PI: 9.2168
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934920.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.52.3e-301059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  XP_010934920.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS 59
                    8***********************************************96 PP

2K-box67.83.7e-2380162789
           K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                     k+  e++a++l+ ++a L k+ie L+ ++R+llGe+Les+ ++eL+ Le qLe+sl++iR++K+++l eqi +l++kek l  
  XP_010934920.1  80 KKSREHNAQQLKSDAASLMKKIERLEASKRKLLGENLESCAIEELHDLELQLEQSLSSIRNRKYQMLEEQICRLKEKEKILTA 162
                     4478999***********************************************************************99864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.777161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-32373IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-31323IPR002100Transcription factor, MADS-box
CDDcd002651.97E-41369No hitNo description
PfamPF003193.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2382162IPR002487Transcription factor, K-box
PROSITE profilePS5129713.51687170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MVRGKTQVRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFSSS  60
SMEKTIDRYI MHAKDVNINK KSREHNAQQL KSDAASLMKK IERLEASKRK LLGENLESCA  120
IEELHDLELQ LEQSLSSIRN RKYQMLEEQI CRLKEKEKIL TASIQEKLNA EPRLQLCAPA  180
VSDDYDSQNT DVETELVIGR PGTCKVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-19372271Myocyte-specific enhancer factor 2A
3mu6_C1e-19372271Myocyte-specific enhancer factor 2A
3mu6_B1e-19372271Myocyte-specific enhancer factor 2A
3mu6_A1e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934920.11e-150PREDICTED: MADS-box transcription factor 50-like isoform X1
RefseqXP_010934921.11e-150PREDICTED: MADS-box transcription factor 50-like isoform X1
SwissprotQ9XJ602e-77MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ400I31e-143Q400I3_ELAGV; AGL20-like MADS box transcription factor
STRINGGSMUA_Achr11P07760_0014e-79(Musa acuminata)
STRINGGSMUA_Achr2P04340_0014e-79(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.18e-68AGAMOUS-like 20